PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0531s0018.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 432aa    MW: 48430.2 Da    PI: 8.5356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0531s0018.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.2e-32249302255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0531s0018.2.p 249 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 302
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15246302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28247302IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23249302IPR006447Myb domain, plants
PfamPF002497.8E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MELFPAQQPD LSLQISPPNT TTKPTSPWPR RTSSAAEEED HHSMDLQGFW KRALDNNNSA  60
TMAAKPNKNS NTKSSSDHYS DILSLSNPSR SIDNPFEPHH HHSLNNNPLI QHNNPFHQIH  120
HHFQSNPQNQ HHHHHHHQAA AAASFLGHHE QLSFLKPIRG IPIYQSPNFN PNNSTNFLHH  180
HQQQQSVLDG LSYLPSSAAS RAANTSYFMN NNINGGGTVS PCTNNNILLR SSSSRFLSRF  240
PGKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY  300
RTVKTTDRAA ASSDAYENGS SGDNSEDLML DITNPIKKGD HQTWGQQGRT STSNQDRENY  360
HGLWSNSSRE AWLHGRPKDS LVGNHINFIE EMDPKPLSYN ERLGEVSSLS EGYSSSNSVK  420
PNLEFTLGRS H*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015898005.11e-114PREDICTED: probable transcription factor KAN2 isoform X3
TrEMBLA0A067KUB81e-112A0A067KUB8_JATCU; Uncharacterized protein
STRINGVIT_02s0012g01940.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.19e-63G2-like family protein